
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: pac
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Streptomyces alboniger
Delivery time: 3-7 business days
Uniprot ID: P13249
AA Sequence: MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIERVTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLAAQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETSAPRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-199aa
Protein length: Full Length
MW: 37.5 kDa
Alternative Name(s):
Relevance: Detoxification of puromycin.
Reference: "Molecular analysis of the pac gene encoding a puromycin N-acetyl transferase from Streptomyces alboniger."Lacalle R.A., Pulido D., Vara J., Zalacain M., Jimenez A.Gene 79:375-380(1989)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Streptomyces alboniger Puromycin N-acetyltransferase(pac)
- Regular price
- £637.00 GBP
- Sale price
- £637.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Puromycin N-acetyltransferase(pac)
- Regular price
- £637.00 GBP
- Sale price
- £637.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Streptomyces alboniger Puromycin N-acetyltransferase(pac)
- Regular price
- £637.00 GBP
- Sale price
- £637.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Transcription factor PU.1(SPI1)
- Regular price
- £480.00 GBP
- Sale price
- £480.00 GBP
- Regular price
-
- Unit price
- per
Sold out