Recombinant Penaeus sp. Sarcoplasmic calcium-binding protein, alpha-B and -A chains

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Penaeus sp. Sarcoplasmic calcium-binding protein, alpha-B and -A chains

CSB-EP355859PEO
Regular price
£631.00 GBP
Sale price
£631.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P02636

Gene Names: N/A

Organism: Penaeus sp. (Penoeid shrimp)

AA Sequence: AYSWDNRVKYVVRYMYDIDDDGFLDKNDFECLAVRNTLIEGRGEFSAADYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKMAVQKHCQGKKYSEFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYDKLTTEDDRKAGGLTLERYQDLYAQFISNPNESCSACFLFGPLKVVQ

Expression Region: 1-192aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 42 kDa

Alternative Name(s):

Relevance: Like parvalbumins, SCP's seem to be more abundant in fast contracting muscles, but no functional relationship can be established from this distribution.

Reference: "Amino acid sequence of alpha chain of sarcoplasmic calcium binding protein obtained from shrimp tail muscle." Takagi T., Konishi K. J. Biochem. 95:1603-1615(1984)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share