>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: N/A
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Oxyuranus microlepidotus (Inland taipan)
Delivery time: 3-7 business days
Uniprot ID: A7X4T2
AA Sequence: LKCHESENLDDHVVCEEDETMCYKFTFVPFRDFEIVARGCSASCPEEKDVVCCSTDLCNK
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 22-81aa
Protein length: Full Length of Mature Protein
MW: 26.9 kDa
Alternative Name(s):
Relevance:
Reference: "Evolution of an arsenal: structural and functional diversification of the venom system in the advanced snakes (Caenophidia)." Fry B.G., Scheib H., van der Weerd L., Young B., McNaughtan J., Ramjan S.F.R., Vidal N., Poelmann R.E., Norman J.A. Mol. Cell. Proteomics 7:215-246(2008)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.