Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q99MS4
Gene Names: Prss29
Organism: Mus musculus (Mouse)
AA Sequence: GTPAPGPEDVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDAGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQRFS
Expression Region: 18-279aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 6xHis-B2M-tagged
MW: 43.1 kDa
Alternative Name(s): Implantation serine proteinase 2 ;ISP-2Strypsin-2Strypsin-related protein;Tryptase-like proteinase
Relevance: Involved in bryo hatching and implantation.
Reference: Embryonic hatching enzyme strypsin/ISP1 is expressed with ISP2 in endometrial glands during implantation.O'Sullivan C.M., Liu S.Y., Karpinka J.B., Rancourt D.E.Mol. Reprod. Dev. 62:328-334(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.