Recombinant Mouse Protein Wnt-8b(Wnt8b)

Recombinant Mouse Protein Wnt-8b(Wnt8b)

CSB-EP895748MO
Regular price
£639.00 GBP
Sale price
£639.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: others

Target / Protein: Wnt8b

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: Q9WUD6

AA Sequence: WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 22-350aa

Protein length: Full Length of Mature Protein

MW: 56.2 kDa

Alternative Name(s):

Relevance: Ligand for members of the frizzled family of seven transmembrane receptors. May play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.

Reference: "Early embryonic lethality in Bmp5;Bmp7 double mutant mice suggests functional redundancy within the 60A subgroup." Solloway M.J., Robertson E.J. Development 126:1753-1768(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Mouse Protein Wnt-8b(Wnt8b)
    Regular price
    £639.00 GBP
    Sale price
    £639.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Protein Wnt-3a(Wnt3a)
    Regular price
    £481.00 GBP
    Sale price
    £481.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Proto-oncogene Wnt-3(Wnt3)
    Regular price
    £544.00 GBP
    Sale price
    £544.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Decorin(Dcn) ,partial
    Regular price
    £544.00 GBP
    Sale price
    £544.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share