
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: others
Target / Protein: Wnt8b
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: Q9WUD6
AA Sequence: WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 22-350aa
Protein length: Full Length of Mature Protein
MW: 56.2 kDa
Alternative Name(s):
Relevance: Ligand for members of the frizzled family of seven transmembrane receptors. May play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.
Reference: "Early embryonic lethality in Bmp5;Bmp7 double mutant mice suggests functional redundancy within the 60A subgroup." Solloway M.J., Robertson E.J. Development 126:1753-1768(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Protein Wnt-8b(Wnt8b)
- Regular price
- £639.00 GBP
- Sale price
- £639.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Protein Wnt-3a(Wnt3a)
- Regular price
- £481.00 GBP
- Sale price
- £481.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Proto-oncogene Wnt-3(Wnt3)
- Regular price
- £544.00 GBP
- Sale price
- £544.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Decorin(Dcn) ,partial
- Regular price
- £544.00 GBP
- Sale price
- £544.00 GBP
- Regular price
-
- Unit price
- per
Sold out