Size:20ug. Other sizes are also available. For further information, please contact us.
Research Areas:Transcription
Uniprot ID:P67778
Gene Names:Phb
Organism:Mus musculus (Mouse)
AA Sequence:RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHL
Expression Region:41-173aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 10xHis-tagged
MW:20.5 kDa
Alternative Name(s):B-cell receptor-associated protein 32 (BAP 32)
Relevance:Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging
Reference:"The IgM antigen receptor of B lymphocytes is associated with prohibitin and a prohibitin-related protein." Terashima M., Kim K.-M., Adachi T., Nielsen P.J., Reth M., Koehler G., Lamers M.C. EMBO J. 13:3782-3792(1994)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging (By similarity).
Involvement in disease:
Subcellular Location:Mitochondrion inner membrane
Protein Families:Prohibitin family
Tissue Specificity:Widely expressed in different tissues.
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Mm&CID=263862
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?mmu:18673
STRING Database Link:https://string-db.org/network/10090.ENSMUSP00000119603
OMIM Database Link:
Lead Time Guidance:3-7 business days