Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Immunology
Uniprot ID:P27612
Gene Names:Plaa
Organism:Mus musculus (Mouse)
AA Sequence:TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC
Expression Region:495-584aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:14.7 kDa
Alternative Name(s):PLA2P (PLAP) (Plap)
Relevance:Plays a role in protein ubiquitination, sorting and degradation through its association with VCP. Involved in ubiquitin-mediated membrane proteins trafficking to late endosomes in an ESCRT-dependent manner, and hence plays a role in synaptic vesicle recycling. May play a role in macroautophagy, regulating for instance the clearance of damaged lysosomes. Plays a role in cerebellar Purkinje cell development. Positively regulates cytosolic and calcium-independent phospholipase A2 activities in a tumor necrosis factor alpha- or lipopolysaccharide-dependent manner, and hence prostaglandin E2 biosynthesis.
Reference:"Large-scale cDNA analysis reveals phased gene expression patterns during preimplantation mouse development." Ko M.S.H., Kitchen J.R., Wang X., Threat T.A., Wang X., Hasegawa A., Sun T., Grahovac M.J., Kargul G.J., Lim M.K., Cui Y., Sano Y., Tanaka T.S., Liang Y., Mason S., Paonessa P.D., Sauls A.D., DePalma G.E. Doi H. Development 127:1737-1749(2000)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Plays a role in protein ubiquitination, sorting and degradation through its association with VCP (By similarity). Involved in ubiquitin-mediated membrane proteins trafficking to late endosomes in an ESCRT-dependent manner, and hence plays a role in synaptic vesicle recycling
Involvement in disease:
Subcellular Location:Nucleus, Cytoplasm, Cell junction, synapse
Protein Families:WD repeat PLAP family
Tissue Specificity:Expressed in the brain, with highest levels in hippocampal neurons, cerebellar granular cell layer and Purkinje cells (PubMed:28413018).
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Mm&CID=490101
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?mmu:18786
STRING Database Link:https://string-db.org/network/10090.ENSMUSP00000102724
OMIM Database Link:
Lead Time Guidance:13-23 business days