>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug
Updated Date: Stock Protein updated on 20171228
Research areas: Cancer
Target / Protein: Mb
Biologically active: Not Tested
Expression system: Mammalian cell
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: P04247
AA Sequence: GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 2-154aa
Protein length: Full Length
MW: 21.9 kDa
Alternative Name(s):
Relevance: Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
Reference: "The mouse myoglobin gene. Characterisation and sequence comparison with other mammalian myoglobin genes." Blanchetot A., Price M., Jeffreys A.J. Eur. J. Biochem. 159:469-474(1986)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.