
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Others
Target / Protein: Amh
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: P27106
AA Sequence: DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC
Tag info: N-terminal 6xHis-tagged
Expression Region: 450-552aa
Protein length: Partial
MW: 13.3 kDa
Alternative Name(s): Anti-Muellerian hormone ;AMH;Muellerian-inhibiting substance ;MIS
Relevance: This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.
Reference: Expression of the mouse anti-Mullerian hormone gene suggests a role in both male and female sexual differentiation.Muensterberg A., Lovell-Badge R.Development 113:613-624(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial
- Regular price
- £534.00 GBP
- Sale price
- £534.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial
- Regular price
- £539.00 GBP
- Sale price
- £539.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Muellerian-inhibiting factor(Amh),partial
- Regular price
- £539.00 GBP
- Sale price
- £539.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Serum amyloid A-1 protein(Saa1)
- Regular price
- £535.00 GBP
- Sale price
- £535.00 GBP
- Regular price
-
- Unit price
- per
Sold out