Recombinant Mouse Major urinary protein 2(Mup2)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Major urinary protein 2(Mup2)

CSB-EP319316MO
Regular price
£566.00 GBP
Sale price
£566.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P11589

Gene Names: Mup2

Organism: Mus musculus (Mouse)

AA Sequence: EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE

Expression Region: 19-180aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 22.7 kDa

Alternative Name(s):

Relevance: Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales.

Reference: Complete 1H, 15N and 13C assignment of a recombinant mouse major urinary protein.Abbate F., Franzoni L., Lohr F., Luecke C., Ferrari E., Sorbi R.T., Rueterjans H., Spisni A.J. Biomol. NMR 15:187-188(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share