Recombinant Mouse Interferon epsilon(Ifne)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Interferon epsilon(Ifne)

CSB-YP800374MO-GB
Regular price
£534.00 GBP
Sale price
£534.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: Q80ZF2

Gene Names: Ifne

Organism: Mus musculus (Mouse)

AA Sequence: LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP

Expression Region: 22-192aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 22 kDa

Alternative Name(s): Interferon epsilon-1Interferon tau-1

Relevance: Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the fale reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections.

Reference: Characterization of the type I interferon locus and identification of novel genes.Hardy M.P., Owczarek C.M., Jermiin L.S., Ejdebaeck M., Hertzog P.J.Genomics 84:331-345(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Mouse Interferon epsilon(Ifne)
    Regular price
    £535.00 GBP
    Sale price
    £535.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Interferon epsilon(IFNE)
    Regular price
    £419.00 GBP
    Sale price
    £419.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Interferon epsilon(IFNE)
    Regular price
    £419.00 GBP
    Sale price
    £419.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Interferon alpha-beta receptor 2(Ifnar2),partial
    Regular price
    £534.00 GBP
    Sale price
    £534.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share