Recombinant Mouse Heparin-binding growth factor 2 protein(Fgf-2)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Heparin-binding growth factor 2 protein(Fgf-2)

CSB-RP062594m-GB
Regular price
£554.00 GBP
Sale price
£554.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P15655

Gene Names: Fgf-2

Organism: Mus musculus (Mouse)

AA Sequence: PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Expression Region: 10-154aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 20.3 kDa

Alternative Name(s): Basic fibroblast growth factor ;bFGFHeparin-binding growth factor 2 ;HBGF-2

Relevance: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro .

Reference: Isolation of cDNAs encoding four mouse FGF family members and characterization of their expression patterns during embryogenesis.Hebert J.M., Basilico C., Goldfarb M., Haub O., Martin G.R.Dev. Biol. 138:454-463(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share