Recombinant Mouse Hemoglobin subunit alpha(Hba)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Hemoglobin subunit alpha(Hba)

CSB-YP010147MO
Regular price
£533.00 GBP
Sale price
£533.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P01942

Gene Names: Hba

Organism: Mus musculus (Mouse)

AA Sequence: VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR

Expression Region: 2-142aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 17 kDa

Alternative Name(s): Alpha-globinHemoglobin alpha chain

Relevance: Involved in oxygen transport from the lung to the various peripheral tissues.

Reference: The complete sequence of a chromosomal mouse alpha-globin gene reveals elements conserved throughout vertebrate evolution.Nishioka Y., Leder P.Cell 18:875-882(1979)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Mouse Hemoglobin subunit alpha(Hba)
    Regular price
    £535.00 GBP
    Sale price
    £535.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Hemoglobin subunit zeta(HBZ)
    Regular price
    £418.00 GBP
    Sale price
    £418.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Myoglobin(Mb)
    Regular price
    £535.00 GBP
    Sale price
    £535.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Myoglobin(Mb)
    Regular price
    £533.00 GBP
    Sale price
    £533.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share