Recombinant Miracle fruit Miraculin

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Miracle fruit Miraculin

CSB-YP320179RES
Regular price
£661.00 GBP
Sale price
£661.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P13087

Gene Names: N/A

Organism: Synsepalum dulcificum (Miracle fruit) (Richadella dulcifica)

AA Sequence: DSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF

Expression Region: 30-220aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 23.4 kDa

Alternative Name(s):

Relevance: Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes.

Reference: "Structural study of asparagine-linked oligosaccharide moiety of taste-modifying protein, miraculin." Takahashi N., Hitotsuya H., Hanzawa H., Arata Y., Kurihara Y. J. Biol. Chem. 265:7793-7798(1990)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share