Recombinant Macaca fascicularis T-cell surface glycoprotein CD3 gamma chain(CD3G),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Macaca fascicularis T-cell surface glycoprotein CD3 gamma chain(CD3G),partial

CSB-YP850179MOV
Regular price
£732.00 GBP
Sale price
£732.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Immunology

Target / Protein: CD3G

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Delivery time: 3-7 business days

Uniprot ID: Q95LI7

AA Sequence: QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT

Tag info: N-terminal 6xHis-tagged

Expression Region: 23-113aa

Protein length: Extracellular Domain

MW: 12.5 kDa

Alternative Name(s): T-cell receptor T3 gamma chain CD_antigen: CD3g

Relevance: The CD3 complex mediates signal transduction.

Reference: "CD3 polymorphism in cynomolgus monkeys (Macaca fascicularis)."Uda A., Tanabayashi K., Mukai R., Yachi M., Nam K., Yamada A.J. Med. Primatol. 30:141-147(2001) .

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share