
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Allergen
Target / Protein: LOLPIB
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Lolium perenne
Delivery time: 3-7 business days
Uniprot ID: Q40240
AA Sequence: ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQSLISLLIYY
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 26-307aa
Protein length: Full Length of Mature Protein
MW: 48.4 kDa
Alternative Name(s): Allergen Lol p Ib Allergen Lol p Va Allergen: Lol p 5a
Relevance:
Reference: "Isolation of cDNA encoding a newly identified major allergenic protein of rye-grass pollen: intracellular targeting to the amyloplast." Singh M.B., Hough T., Theerakulpisut P., Avjioglu A., Davies S., Smith P.M., Taylor P., Simpson R.J., Ward L.D., McCluskey J., Puy R., Knox R.B.Proc. Natl. Acad. Sci. U.S.A. 88:1384-1388(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Lolium perenne Major pollen allergen Lol p 5a(LOLPIB)
- Regular price
- £630.00 GBP
- Sale price
- £630.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Lolium perenne Pollen allergen Lol p 1
- Regular price
- £620.00 GBP
- Sale price
- £620.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Phleum pratense Pollen allergen Phl p 5a
- Regular price
- £536.00 GBP
- Sale price
- £536.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cynodon dactylon Major pollen allergen Cyn d 1(CYND1)
- Regular price
- £630.00 GBP
- Sale price
- £630.00 GBP
- Regular price
-
- Unit price
- per
Sold out