Recombinant Laribacter hongkongensis Orotate phosphoribosyltransferase(pyrE)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Laribacter hongkongensis Orotate phosphoribosyltransferase(pyrE)

CSB-EP506933LNO
Regular price
£632.00 GBP
Sale price
£632.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: pyrE

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Laribacter hongkongensis (strain HLHK9)

Delivery time: 3-7 business days

Uniprot ID: C1D6F5

AA Sequence: MSDFRQDFIRFAVEEQVLRFGEFVTKAGRPSPYFFNAGLFNHGASLLSLARFYARSISESGIAFDMLFGPAYKGIVLAGATAMMLAEQGRDVPFAFNRKEAKDHGEGGTLIGAPLKGRVLIIDDVISAGTSVRESVEIIRANGAEPAGVAIALDRMERGQGELSATQEVAQKFGLPVVAIASLDDLLGFLAGSPDLADNLTRVEAYRTQYGVR

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-213aa

Protein length: Full Length

MW: 38.9 kDa

Alternative Name(s): Short name:OPRT Short name:OPRTase

Relevance: Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP).

Reference: "The complete genome and proteome of Laribacter hongkongensis reveal potential mechanisms for adaptations to different temperatures and habitats."Woo P.C.Y., Lau S.K.P., Tse H., Teng J.L.L., Curreem S.O., Tsang A.K.L., Fan R.Y.Y., Wong G.K.M., Huang Y., Loman N.J., Snyder L.A.S., Cai J.J., Huang J.-D., Mak W., Pallen M.J., Lok S., Yuen K.-Y.PLoS Genet. 5:E1000416-E1000416(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Phosphoribosylamine--glycine ligase(purD)
    Regular price
    £632.00 GBP
    Sale price
    £632.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Intestinal-type alkaline phosphatase(ALPI),partial
    Regular price
    £421.00 GBP
    Sale price
    £421.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Hypocrea rufa Endo-beta-1,6-galactanase(6GAL)
    Regular price
    £632.00 GBP
    Sale price
    £632.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Agrobacterium sp. 3-phosphoshikimate 1-carboxyvinyltransferase(aroA)
    Regular price
    £632.00 GBP
    Sale price
    £632.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share