Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans)
Uniprot NO.:C5E368
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAFEPSRYQDPRTWKMTPAMIRARRPFFKKNLLGLGILVSVTGGIYVYTHRFLNRDNDFA DVPIPPIDPKELEQLKKEYEQHKRDVAARDE
Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial
Gene Names:Name:COA3 Ordered Locus Names:KLTH0H10802g
Expression Region:1-91
Sequence Info:full length protein