Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14),partial,Biotinylated (Active)

Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14),partial,Biotinylated (Active)

CSB-MP023991HUj7-B
Regular price
£456.00 GBP
Sale price
£456.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Immunology

Uniprot NO.:O43557

Uniprot Entry Name:

Gene Names:TNFSF14

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:74-240aa

Sequence:DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

Protein Description:Partial

Tag Info:N-terminal hFc-Avi-tagged

Mol. Weight:47.3 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF14 (CSB-MP842173HU) at 5 ?g/ml can bind Biotinylated human TNFSF14, the EC50 is 1.773-3.707 ng/ml.

Purity:Greater than 92% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:

Relevance:

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human Tumor necrosis factor receptor superfamily member 14(TNFRSF14) ,partial (Active)
    Regular price
    £268.00 GBP
    Sale price
    £268.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14),partial (Active)
    Regular price
    £316.00 GBP
    Sale price
    £316.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Tumor necrosis factor ligand superfamily member 9(TNFSF9),partial (Active)
    Regular price
    £282.00 GBP
    Sale price
    £282.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial (Active)
    Regular price
    £240.00 GBP
    Sale price
    £240.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share