
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Cardiovascular
Uniprot ID: P13726
Gene Names: F3
Organism: Homo sapiens (Human)
AA Sequence: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
Expression Region: 33-251aa
Sequence Info: Extracellular Domain
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 40.8 kDa
Alternative Name(s): Coagulation factor IIIThromboplastin; CD142
Relevance: Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hostasis by initiating the cell-surface assbly and propagation of the coagulation protease cascade.
Reference: Human tissue factor cDNA sequence and chromosome localization of the gene.Scarpati E.M., Wen D., Broze G.J. Jr., Miletich J.P., Flandermeyer R.R., Siegel N.R., Sadler J.E.Biochemistry 26:5234-5238(1987)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Tissue factor(F3),partial
- Regular price
- £431.00 GBP
- Sale price
- £431.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Coagulation factor VII(F7),partial
- Regular price
- £626.00 GBP
- Sale price
- £626.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Coagulation factor XI(F11),partial
- Regular price
- £551.00 GBP
- Sale price
- £551.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Butyrophilin subfamily 3 member A2(BTN3A2),partial
- Regular price
- £431.00 GBP
- Sale price
- £431.00 GBP
- Regular price
-
- Unit price
- per
Sold out