Recombinant Human Store-operated calcium entry-associated regulatory factor(SARAF),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Store-operated calcium entry-associated regulatory factor(SARAF),partial

CSB-EP853392HU
Regular price
£426.00 GBP
Sale price
£426.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Biochemicals

Uniprot ID: Q96BY9

Gene Names: SARAF

Organism: Homo sapiens (Human)

AA Sequence: SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR

Expression Region: 195-339aa

Sequence Info: Cytoplasmic Domain

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 31.5 kDa

Alternative Name(s): HBV X-transactivated gene 3 proteinHBV XAg-transactivated protein 3;Protein FOAP-7Transmembrane protein 66

Relevance: Negative regulator of store-operated Ca2+ entry (SOCE) involved in protecting cells from Ca2+ overfilling. In response to cytosolic Ca2+ elevation after endoplasmic reticulum Ca2+ refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca2+ levels, and thus preventing the overload of the cell with excessive Ca2+ ions.

Reference: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.DNA Res. 12:117-126(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Store-opeRated calcium entry-associated regulatory factor(SARAF),partial
    Regular price
    £476.00 GBP
    Sale price
    £476.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Transcriptional enhancer factor TEF-1(TEAD1)
    Regular price
    £476.00 GBP
    Sale price
    £476.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Transcriptional enhancer factor TEF-5(TEAD3),partial
    Regular price
    £426.00 GBP
    Sale price
    £426.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Caspase-3(CASP3),partial
    Regular price
    £426.00 GBP
    Sale price
    £426.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share