Recombinant Human Selenoprotein P(SEPP1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Selenoprotein P(SEPP1)

CSB-YP021018HU
Regular price
£469.00 GBP
Sale price
£469.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P49908

Gene Names: SEPP1

Organism: Homo sapiens (Human)

AA Sequence: ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN

Expression Region: 20-381aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 42.6 kDa

Alternative Name(s):

Relevance: Might be responsible for some of the Extracellular domain antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis.

Reference: Conserved nucleotide sequences in the open reading frame and 3' untranslated region of selenoprotein P mRNA.Hill K.E., Lloyd R.S., Burk R.F.Proc. Natl. Acad. Sci. U.S.A. 90:537-541(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Selenoprotein P(SEPP1)
    Regular price
    £420.00 GBP
    Sale price
    £420.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Selenoprotein P(SEPP1)
    Regular price
    £420.00 GBP
    Sale price
    £420.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Selenoprotein M(SELM)
    Regular price
    £541.00 GBP
    Sale price
    £541.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human N-myc proto-oncogene protein(MYCN)
    Regular price
    £469.00 GBP
    Sale price
    £469.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share