Recombinant Human Ropporin-1B(ROPN1B)

CSB-YP020065HU

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Signal Transduction

Uniprot ID: Q9BZX4

Gene Names: ROPN1B

Organism: Homo sapiens (Human)

AA Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE

Expression Region: 1-120aa

Sequence Info: Full Length of isoform 2

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 15.6 kDa

Alternative Name(s): Rhophilin-associated protein 1B

Relevance:

Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.