Recombinant Human Pulmonary surfactant-associated protein D(SFTPD)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Pulmonary surfactant-associated protein D(SFTPD)

CSB-YP021175HU
Regular price
£533.00 GBP
Sale price
£533.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Cancer

Uniprot ID: P35247

Gene Names: SFTPD

Organism: Homo sapiens (Human)

AA Sequence: AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF

Expression Region: 21–375aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 35.2 kDa

Alternative Name(s): Collectin-7 Lung surfactant protein D

Relevance: Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. May participate in the Extracellular domain reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties.

Reference: "Purification, characterization and cDNA cloning of human lung surfactant protein D."Lu J., Willis A.C., Reid K.B.M.Biochem. J. 284:795-802(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Pulmonary surfactant-associated protein A2(SFTPA2)
    Regular price
    £484.00 GBP
    Sale price
    £484.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Pulmonary surfactant-associated protein C(SFTPC)
    Regular price
    £535.00 GBP
    Sale price
    £535.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)
    Regular price
    £380.00 GBP
    Sale price
    £380.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)
    Regular price
    £345.00 GBP
    Sale price
    £345.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share