Recombinant Human Protein SCO2 homolog, mitochondrial(SCO2)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Protein SCO2 homolog, mitochondrial(SCO2)

CSB-EP020853HU
Regular price
£433.00 GBP
Sale price
£433.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Metabolism

Uniprot ID: O43819

Gene Names: SCO2

Organism: Homo sapiens (Human)

AA Sequence: PAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS

Expression Region: 43-266aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 41.1 kDa

Alternative Name(s):

Relevance: Acts as a copper chaperone, transporting copper to the Cu(A) site on the cytochrome c oxidase subunit II (COX2).

Reference: Mutations in SCO2 are associated with autosomal-dominant high-grade myopia.Tran-Viet K.N., Powell C., Barathi V.A., Klemm T., Maurer-Stroh S., Limviphuvadh V., Soler V., Ho C., Yanovitch T., Schneider G., Li Y.J., Nading E., Metlapally R., Saw S.M., Goh L., Rozen S., Young T.L.Am. J. Hum. Genet. 92:820-826(2013)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share