
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cancer
Uniprot NO.:Q9NZQ7
Uniprot Entry Name:
Gene Names:CD274
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:19-238aa
Sequence:FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Protein Description:Partial
Tag Info:C-terminal hFc-tagged
Mol. Weight:52.7 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 ?g/ml can bind Anti- PD-L1 mouse monoclonal antibody(CSB-MA878942A1m?antigen from E.coli), the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL.
Purity:Greater than 95% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:PD-L1 (PDCD1 ligand 1) (Programmed death ligand 1) (hPD-L1) (B7 homolog 1) (B7-H1) (CD274)
Relevance:Plays a critical role in induction and maintenance of immune tolerance to self (PubMed:11015443, PubMed:28813417, PubMed:28813410). As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cells and limits T-cell effector response (PubMed:11015443, PubMed:28813417, PubMed:28813410). Through a yet unknown activating receptor, may costimulate T-cell subsets that predominantly produce interleukin-10 (IL10) (PubMed:10581077) The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival (PubMed:28813417, PubMed:28813410). The interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function (By similarity). The blockage of the PDCD1-mediated pathway results in the reversal of the exhausted T-cell phenotype and the normalization of the anti-tumor response, providing a rationale for cancer immunotherapy (By similarity).
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human Programmed cell death protein 1(PDCD1),partial (Active)
- Regular price
- £268.00 GBP
- Sale price
- £268.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human CD276 antigen(CD276),partial (Active)
- Regular price
- £282.00 GBP
- Sale price
- £282.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human ICOS ligand(ICOSLG),partial (Active)
- Regular price
- £330.00 GBP
- Sale price
- £330.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human T-cell antigen CD7(CD7),partial (Active)
- Regular price
- £316.00 GBP
- Sale price
- £316.00 GBP
- Regular price
-
- Unit price
- per
Sold out