Recombinant Human Platelet glycoprotein Ib beta chain(GP1BB)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Platelet glycoprotein Ib beta chain(GP1BB)

CSB-CF009686HU
Regular price
£969.00 GBP
Sale price
£969.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P13224

Gene Names: GP1BB

Organism: Homo sapiens (Human)

AA Sequence: CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES

Expression Region: 26-206aa

Sequence Info: Full Length of Mature Protein

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 39.3 kDa

Alternative Name(s): Antigen CD42b-beta CD_antigen: CD42c

Relevance: Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.

Reference: "The alpha and beta chains of human platelet glycoprotein Ib are both transmembrane proteins containing a leucine-rich amino acid sequence." Lopez J.A., Chung D.W., Fujikawa K., Hagen F.S., Davie E.W., Roth G.J. Proc. Natl. Acad. Sci. U.S.A. 85:2135-2139(1988)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Platelet glycoprotein Ib beta chain(GP1BB)
    Regular price
    £969.00 GBP
    Sale price
    £969.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Platelet glycoprotein Ib alpha chain(GP1BA),partial
    Regular price
    £544.00 GBP
    Sale price
    £544.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Platelet glycoprotein Ib alpha chain(GP1BA),partial
    Regular price
    £475.00 GBP
    Sale price
    £475.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Platelet glycoprotein Ib alpha chain(GP1BA),partial
    Regular price
    £425.00 GBP
    Sale price
    £425.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share