Recombinant Human Nucleoside diphosphate kinase A(NME1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Nucleoside diphosphate kinase A(NME1)

CSB-RP027754h
Regular price
£433.00 GBP
Sale price
£433.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Developmental Biology

Uniprot ID: P15531

Gene Names: NME1

Organism: Homo sapiens (Human)

AA Sequence: ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

Expression Region: 2-152aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 44 kDa

Alternative Name(s): Granzyme A-activated DNase ;GAADMetastasis inhibition factor nm23NM23-H1Tumor metastatic process-associated protein

Relevance: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Possesses nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease activities. Involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression. Required for neural development including neural patterning and cell fate determination. During GZMA-mediated cell death, works in concert with TREX1. NME1 nicks one strand of DNA and TREX1 roves bases from the free 3' end to enhance DNA damage and prevent DNA end reannealing and rapid repair.

Reference: Isolation and characterization of a novel human NM23-H1B gene, a different transcript of NM23-H1.Ni X., Gu S., Dai J., Cheng H., Guo L., Li L., Ji C., Xie Y., Ying K., Mao Y.J. Hum. Genet. 48:96-100(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share