Recombinant Human Novel Coronavirus Spike glycoprotein(S),partial (Active)

Recombinant Human Novel Coronavirus Spike glycoprotein(S),partial (Active)

CSB-MP3324GMY
Regular price
£3,134.00 GBP
Sale price
£3,134.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:1mg. Other sizes are also available. Please contact us.

Research Areas:Microbiology

Uniprot NO.:P0DTC2

Uniprot Entry Name:

Gene Names:S

Species:Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Source:Mammalian cell

Expression Region:16-685aa

Sequence:VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR

Protein Description:Partial

Tag Info:N-terminal 10xHis-tagged and C-terminal Flag-tagged

Mol. Weight:79.6 kDa

Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 ?g/ml can bind human ACE2 (CSB-MP866317HU), the EC50 of SARS-CoV-2-S protein is 56.64 - 103.6 ng/ml. ?Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 ?g/ml can bind SARS-CoV-2-S Antibody (CSB-RA33245A1GMY), the EC50 of SARS-CoV-2-S protein is 36.79-48.87 ng/ml.

Purity:Greater than 85% as determined by SDS-PAGE.

Endotoxin:Not test.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:

Relevance:

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Your list is ready to share