Recombinant Human Neuroserpin protein(SERPINI1) (Active)

Recombinant Human Neuroserpin protein(SERPINI1) (Active)

CSB-AP000141HU
Regular price
£890.00 GBP
Sale price
£890.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Neuroscience

Uniprot NO.:Q99574

Uniprot Entry Name:NEUS_HUMAN

Gene Names:SERPINI1,PI12

Species:Homo sapiens (Human)

Source:E.Coli

Expression Region:17-410aa

Sequence:TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL

Protein Description:Full Length of Mature Protein

Tag Info:Tag-Free

Mol. Weight:44.7 kDa

Biological_Activity:Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using rat C6 cells is less than 0.5 ?g/ml, corresponding to a specific activity of > 2000 IU/mg.

Purity:>95% as determined by SDS-PAGE and HPLC.

Endotoxin:Less than 1.0 EU/µg as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 µm filtered PBS, pH 7.5

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:Peptidase inhibitor 12, Serpin I1

Relevance:Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin. May be involved in the formation or reorganization of synaptic connections as well as for synaptic plasticity in the adult nervous system. May protect neurons from cell damage by tissue-type plasminogen activator.

PubMed ID:9070919; 14702039; 17974005; 15489334; 10517635

Function:Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin

Involvement in disease:Encephalopathy, familial, with neuroserpin inclusion bodies (FENIB)

Subcellular Location:Secreted, Cytoplasmic vesicle, secretory vesicle lumen, Perikaryon

Protein Families:Serpin family

Tissue Specificity:Detected in brain cortex and hippocampus pyramidal neurons (at protein level) (PubMed:17040209). Predominantly expressed in the brain (PubMed:9070919).

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:8943

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=478153

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:5274

STRING Database Link:https://string-db.org/network/9606.ENSP00000295777

OMIM Database Link:https://www.omim.org/entry/602445602445602445

Your list is ready to share