
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: Q5VU43
Gene Names: PDE4DIP
Organism: Homo sapiens (Human)
AA Sequence: MKGTDSGSCCRRRCDFGCCCRASRRAHYTPYRSGDATRTPQSPRQTPSRERRRPEPAGSWAAAAEEEEAAAAATPWMRDYFAEDDGEMVPRTSHTAAFLSDTKDRGPPVQSQIWRSGEKVPFVQTYSLRAFEKPPQVQTQALRDFEKHLNDLKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKRELQDKKQHLDKTWADVENLNSQNEAELRRQFEERQQETEHVYELLENKIQLLQEESRLAKNEAARMAALVEAEKECNLELSEKLKGVTKNWEDVPGDQVKPDQYTEALAQRDK
Expression Region: 1-310aa
Sequence Info: Full Length of Isoform 8
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 63.1 kDa
Alternative Name(s): Cardiomyopathy-associated protein 2 Phosphodiesterase 4D-interacting protein
Relevance: May function as an anchor sequestering components of the cAMP-dependent pathway to Golgi and/or centrosomes.
Reference: "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Serpin B4(SERPINB4)
- Regular price
- £537.00 GBP
- Sale price
- £537.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human N-myc proto-oncogene protein(MYCN)
- Regular price
- £469.00 GBP
- Sale price
- £469.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Nucleolin(NCL),Partial
- Regular price
- £469.00 GBP
- Sale price
- £469.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Biglycan(BGN)
- Regular price
- £420.00 GBP
- Sale price
- £420.00 GBP
- Regular price
-
- Unit price
- per
Sold out