Recombinant Human Large neutral amino acids transporter small subunit 3(SLC43A1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Large neutral amino acids transporter small subunit 3(SLC43A1),partial

CSB-RP133474h
Regular price
£446.00 GBP
Sale price
£446.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Transport

Uniprot ID: O75387

Gene Names: SLC43A1

Organism: Homo sapiens (Human)

AA Sequence: TLNWPIEAFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLCSPT

Expression Region: 214-303aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 13.9 kDa

Alternative Name(s): L-type amino acid transporter 3;Prostate cancer overexpressed gene 1 protein;Solute carrier family 43 member 1

Relevance: Sodium-independent, high affinity transport of large neutral amino acids. Has narrower substrate selectivity compared to SLC7A5 and SLC7A8 and mainly transports branched-chain amino acids and phenylalanine. Plays a role in the development of human prostate cancer, from prostatic intraepithelial neoplasia to invasive prostate cancer.

Reference: Identification of a novel transcript up-regulated in a clinically aggressive prostate carcinoma.Chuaqui R.F., Englert C.R., Strup S.E., Vocke C.D., Zhuang Z., Duray P.H., Bostwick D.G., Linehan W.M., Liotta L.A., Emmert-Buck M.R.Urology 50:302-307(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share