Recombinant Human Interleukin-13(IL13),partial

Recombinant Human Interleukin-13(IL13),partial

CSB-MP011590HU1
Regular price
£922.00 GBP
Sale price
£922.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Immunology

Uniprot ID:P35225

Gene Names:IL13

Organism:Homo sapiens (Human)

AA Sequence:TVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDL

Expression Region:21-132aa

Sequence Info:Partial

Source:Mammalian cell

Tag Info:C-terminal hFc-Myc-tagged

MW:42

Alternative Name(s):IL-13

Relevance:Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages.

Reference:"Coexpression of the interleukin-13 and interleukin-4 genes correlates with their physical linkage in the cytokine gene cluster on human chromosome 5q23-31." Dolganov G., Bort S., Lovett M., Burr J., Schubert L., Short D., McGurn M., Gibson C., Lewis D.B. Blood 87:3316-3326(1996)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:18-28 business days

You may also like

  • Recombinant Human Interleukin-31(IL31)
    Regular price
    £386.00 GBP
    Sale price
    £386.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Interleukin-13 protein(Il13),partial (Active)
    Regular price
    £1,462.00 GBP
    Sale price
    £1,462.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Interleukin-13 receptor subunit alpha-1(IL13RA1)
    Regular price
    £1,055.00 GBP
    Sale price
    £1,055.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rhesus Macaque Interleukin-13 protein(IL13) (Active)
    Regular price
    £1,740.00 GBP
    Sale price
    £1,740.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share