Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cancer
Uniprot ID: P05013
Gene Names: IFNA6
Organism: Homo sapiens (Human)
AA Sequence: SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE
Expression Region: 21-189aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 25.1 kDa
Alternative Name(s): Interferon alpha-54 Interferon alpha-K Short name: LeIF K
Relevance: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Reference: "Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes." Janssen R., Bont L., Siezen C.L., Hodemaekers H.M., Ermers M.J., Doornbos G., van 't Slot R., Wijmenga C., Goeman J.J., Kimpen J.L., van Houwelingen H.C., Kimman T.G., Hoebee B. J. Infect. Dis. 196:826-834(2007)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.