Recombinant Human Growth hormone receptor(GHR),partial (Active)

Recombinant Human Growth hormone receptor(GHR),partial (Active)

CSB-MP009411HU
Regular price
£325.00 GBP
Sale price
£325.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cancer

Uniprot NO.:P10912

Uniprot Entry Name:

Gene Names:GHR

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:27-264aa

Sequence:AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY

Protein Description:Partial

Tag Info:C-terminal hFc-tagged

Mol. Weight:58.8 kDa

Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized GH1 (CSB-MP009407HU) at 1 ?g/ml can bind human GHR, the EC50 of human GHR protein is 24.96-33.39 ng/ml. ?Human GH1 protein his/myc tag (CSB-MP009407HU) captured on COOH chip can bind Human GHR protein Fc tag (CSB-MP009411HU) with an affinity constant of 6.1 nM as detected by LSPR Assay.

Purity:Greater than 90% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:Somatotropin receptor (Serum-binding protein)

Relevance:Receptor for pituitary gland growth hormone involved in regulating postnatal body growth.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human Growth hormone receptor(GHR),partial,Biotinylated (Active)
    Regular price
    £462.00 GBP
    Sale price
    £462.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Somatotropin(GH1) (Active)
    Regular price
    £277.00 GBP
    Sale price
    £277.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human UL16-binding protein 1(ULBP1) (Active)
    Regular price
    £325.00 GBP
    Sale price
    £325.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human T-cell antigen CD7(CD7),partial (Active)
    Regular price
    £311.00 GBP
    Sale price
    £311.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share