Recombinant Human Formimidoyltransferase-cyclodeaminase(FTCD)

Recombinant Human Formimidoyltransferase-cyclodeaminase(FTCD)

CSB-YP009029HU
Regular price
£508.00 GBP
Sale price
£508.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:O95954

Gene Names:FTCD

Organism:Homo sapiens (Human)

AA Sequence:MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

Expression Region:1-541aa

Sequence Info:Full Length

Source:Yeast

Tag Info:C-terminal 6xHis-tagged

MW:60 kDa

Alternative Name(s):Formimidoyltransferase-cyclodeaminase(Formiminotransferase-cyclodeaminase)(FTCD)(LCHC1) [Includes: Glutamate formimidoyltransferase(EC 2.1.2.5)(Glutamate formiminotransferase)(Glutamate formyltransferase); Formimidoyltetrahydrofolate cyclodeaminase(EC 4.3.1.4)(Formiminotetrahydrofolate cyclodeaminase)]

Relevance:Folate-dependent enzyme, that displays both transferase and deaminase activity. Serves to channel one-carbon units from formiminoglutamate to the folate pool.; Binds and promotes bundling of vimentin filaments originating from the Golgi.

Reference:"Using a yeast two-hybrid system to identify FTCD as a new regulator for HIF-1alpha in HepG2 cells." Yu Z., Ge Y., Xie L., Zhang T., Huang L., Zhao X., Liu J., Huang G. Cell Signal 26:1560-1566(2014)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

You may also like

  • Recombinant Human Protein-arginine deiminase type-4(PADI4)
    Regular price
    £433.00 GBP
    Sale price
    £433.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Cyclic GMP-AMP synthase(CGAS),partial
    Regular price
    £386.00 GBP
    Sale price
    £386.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Peptidyl-prolyl cis-trans isomerase-like 4(PPIL4)
    Regular price
    £424.00 GBP
    Sale price
    £424.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Protein kinase C delta type(PRKCD)
    Regular price
    £509.00 GBP
    Sale price
    £509.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share