Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 3(EIF4EBP3)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 3(EIF4EBP3)

CSB-EP007565HU
Regular price
£437.00 GBP
Sale price
£437.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: O60516

Gene Names: EIF4EBP3

Organism: Homo sapiens (Human)

AA Sequence: MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI

Expression Region: 1-100aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 26.9 kDa

Alternative Name(s):

Relevance: Repressor of translation initiation that regulates EIF4E activity by preventing its assbly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation.

Reference: 4E-BP3, a new member of the eukaryotic initiation factor 4E-binding protein family.Poulin F., Gingras A.-C., Olsen H., Chevalier S., Sonenberg N.J. Biol. Chem. 273:14002-14007(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share