
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cancer
Uniprot NO.:P16410
Uniprot Entry Name:
Gene Names:CTLA4
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:37-162aa
Sequence:AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF
Protein Description:Partial
Tag Info:C-terminal hFc-tagged
Mol. Weight:42.5 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized CD152 at 2 ?g/ml can bind Anti-CD152 rabbit monoclonal antibody(CSB-RA213310A0HU), the EC50 of human CD152 protein is 27.14-34.82 ng/ml.
Purity:Greater than 91% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:Cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4) (CD_antigen: CD152) (CD152)
Relevance:Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human Cytotoxic T-lymphocyte protein 4(CTLA4),partial
- Regular price
- £432.00 GBP
- Sale price
- £432.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Cytotoxic T-lymphocyte protein 4(CTLA4)
- Regular price
- £915.00 GBP
- Sale price
- £915.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rabbit Cytotoxic T-lymphocyte protein 4(CTLA4)
- Regular price
- £915.00 GBP
- Sale price
- £915.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human CD40 ligand(CD40LG),partial (Active)
- Regular price
- £473.00 GBP
- Sale price
- £473.00 GBP
- Regular price
-
- Unit price
- per
Sold out