>Several Other Sizes Are Also Available. Please Inquire. Default Size: 10ug
Updated Date: Stock Protein updated on 20171228
Research areas: Microbiology
Target / Protein: CLDN6
Biologically active: Not Tested
Expression system: in vitro E.coli expression system
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P56747
AA Sequence: MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARA
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-82aa
Protein length: Partial
MW: 24.8 kDa
Alternative Name(s): Skullin
Relevance: Plays a major role in tight junction-specific obliteration of the intercellular space (By similarity). May act as a coreceptor for HCV entry into hepatic cells.
Reference: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.