Recombinant Human Cellular retinoic acid-binding protein 1(CRABP1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Cellular retinoic acid-binding protein 1(CRABP1)

CSB-EP005935HU
Regular price
£437.00 GBP
Sale price
£437.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Transport

Uniprot ID: P29762

Gene Names: CRABP1

Organism: Homo sapiens (Human)

AA Sequence: PNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE

Expression Region: 2-137aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 42.5 kDa

Alternative Name(s): Cellular retinoic acid-binding protein I ;CRABP-I

Relevance: Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors.

Reference: Structures of cellular retinoic acid binding proteins I and II in complex with synthetic retinoids.Chaudhuri B.N., Kleywegt G.J., Broutin-L'Hermite I., Bergfors T., Senn H., Le Motte P., Partouche O., Jones T.A.Acta Crystallogr. D 55:1850-1857(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share