
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cancer
Uniprot NO.:P09326
Uniprot Entry Name:
Gene Names:CD48
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:27-220aa
Sequence:QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS
Protein Description:Full Length of Mature Protein
Tag Info:C-terminal hFc-tagged
Mol. Weight:51.3 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 ?g/ml can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.5806-0.8463 ng/ml.
Purity:Greater than 95% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:B-lymphocyte activation marker BLAST-1 (BCM1 surface antigen) (Leukocyte antigen MEM-102) (SLAM family member 2) (SLAMF2) (Signaling lymphocytic activation molecule 2) (TCT.1) (CD48) (BCM1) (BLAST1)
Relevance:Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human CD44 antigen(CD44),partial (Active)
- Regular price
- £330.00 GBP
- Sale price
- £330.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human CD44 antigen(CD44),partial,Biotinylated (Active)
- Regular price
- £470.00 GBP
- Sale price
- £470.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Basigin(BSG),partial (Active)
- Regular price
- £330.00 GBP
- Sale price
- £330.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Membrane cofactor protein(CD46) (Active)
- Regular price
- £316.00 GBP
- Sale price
- £316.00 GBP
- Regular price
-
- Unit price
- per
Sold out