
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Metabolism
Target / Protein: COMT
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P21964
AA Sequence: GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Tag info: N-terminal 6xHis-tagged
Expression Region: 52-271aa
Protein length: Partial
MW: 28.3 kDa
Alternative Name(s):
Relevance: Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
Reference: Cloning and characterization of human placental catechol-O-methyltransferase cDNA.Lundstroem K., Salminen M., Jalanko A., Savolainen R., Ulmanen I.DNA Cell Biol. 10:181-189(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Catechol O-methyltransferase(COMT),partial
- Regular price
- £430.00 GBP
- Sale price
- £430.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Cathepsin O(CTSO)
- Regular price
- £380.00 GBP
- Sale price
- £380.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Cathepsin O(CTSO)
- Regular price
- £391.00 GBP
- Sale price
- £391.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Cathepsin O(CTSO)
- Regular price
- £444.00 GBP
- Sale price
- £444.00 GBP
- Regular price
-
- Unit price
- per
Sold out