Recombinant Human C-C motif chemokine 8(CCL8)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human C-C motif chemokine 8(CCL8)

CSB-EP004802HU
Regular price
£434.00 GBP
Sale price
£434.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: P80075

Gene Names: CCL8

Organism: Homo sapiens (Human)

AA Sequence: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Expression Region: 24-99aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 35.9 kDa

Alternative Name(s): HC14;Monocyte chemoattractant protein 2;Monocyte chemotactic protein 2 ;MCP-2;Small-inducible cytokine A8

Relevance: Chotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chotactic activity, but inhibits the chotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.

Reference: Complete crystal structure of monocyte chemotactic protein-2, a CC chemokine that interacts with multiple receptors.Blaszczyk J., Coillie E.V., Proost P., Damme J.V., Opdenakker G., Bujacz G.D., Wang J.M., Ji X.Biochemistry 39:14075-14081(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share