Recombinant Human Annexin A4(ANXA4)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Annexin A4(ANXA4)

CSB-EP001845HU
Regular price
£568.00 GBP
Sale price
£568.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Cardiovascular

Target / Protein: ANXA4

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P09525

AA Sequence: ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 2-319aa

Protein length: Full Length

MW: 55.8 kDa

Alternative Name(s): 35-beta calcimedin Annexin IV Annexin-4 Carbohydrate-binding protein p33/p41 Chromobindin-4 Endonexin I Lipocortin IV P32.5 PP4-X Placental anticoagulant protein II

Relevance: Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.

Reference: "Placental anticoagulant proteins: isolation and comparative characterization four members of the lipocortin family." Tait J.F., Sakata M., McMullen B.A., Miao C.H., Funakoshi T., Hendrickson L.E., Fujikawa K. Biochemistry 27:6268-6276(1988)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share