Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Neuroscience
Uniprot ID:P42127
Gene Names:ASIP
Organism:Homo sapiens (Human)
AA Sequence:HLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCA
Expression Region:23-112aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 6xHis-GST-tagged
MW:41.3 kDa
Alternative Name(s):ASP;Agouti switch protein
Relevance:Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment). In higher primates, agouti may affect the quality of hair pigmentation rather than its pattern of deposition. Could well play a role in neuroendocrine aspects of melanocortin action. May have some functional role in regulating the lipid metabolism with adipocytes.
Reference:"ASIP and TYR pigmentation variants associate with cutaneous melanoma and basal cell carcinoma." Gudbjartsson D.F., Sulem P., Stacey S.N., Goldstein A.M., Rafnar T., Sigurgeirsson B., Benediktsdottir K.R., Thorisdottir K., Ragnarsson R., Sveinsdottir S.G., Magnusson V., Lindblom A., Kostulas K., Botella-Estrada R., Soriano V., Juberias P., Grasa M., Saez B. Stefansson K. Nat Genet 40:886-891(2008)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days