Recombinant Human Acetylcholine receptor subunit gamma(CHRNG),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Acetylcholine receptor subunit gamma(CHRNG),partial

CSB-YP005401HU
Regular price
£608.00 GBP
Sale price
£608.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Neuroscience

Uniprot ID: P07510

Gene Names: CHRNG

Organism: Homo sapiens (Human)

AA Sequence: RNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRK

Expression Region: 23-240aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 27.5 kDa

Alternative Name(s):

Relevance: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Reference: "Cloning and sequence analysis of human genomic DNA encoding gamma subunit precursor of muscle acetylcholine receptor."Shibahara S., Kubo T., Perski H.J., Takahashi H., Noda M., Numa S.Eur. J. Biochem. 146:15-22(1985)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Acetylcholine receptor subunit alpha(CHRNA1),partial
    Regular price
    £419.00 GBP
    Sale price
    £419.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Acetylcholine receptor subunit alpha(Chrna1),partial
    Regular price
    £534.00 GBP
    Sale price
    £534.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Acetylcholine receptor subunit alpha(Chrna1),partial
    Regular price
    £535.00 GBP
    Sale price
    £535.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Acetylcholine receptor subunit alpha(CHRNA1),partial
    Regular price
    £419.00 GBP
    Sale price
    £419.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share