
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Neuroscience
Uniprot ID: P07510
Gene Names: CHRNG
Organism: Homo sapiens (Human)
AA Sequence: RNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRK
Expression Region: 23-240aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 27.5 kDa
Alternative Name(s):
Relevance: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Reference: "Cloning and sequence analysis of human genomic DNA encoding gamma subunit precursor of muscle acetylcholine receptor."Shibahara S., Kubo T., Perski H.J., Takahashi H., Noda M., Numa S.Eur. J. Biochem. 146:15-22(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Acetylcholine receptor subunit alpha(CHRNA1),partial
- Regular price
- £419.00 GBP
- Sale price
- £419.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Acetylcholine receptor subunit alpha(Chrna1),partial
- Regular price
- £534.00 GBP
- Sale price
- £534.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Acetylcholine receptor subunit alpha(Chrna1),partial
- Regular price
- £535.00 GBP
- Sale price
- £535.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Acetylcholine receptor subunit alpha(CHRNA1),partial
- Regular price
- £419.00 GBP
- Sale price
- £419.00 GBP
- Regular price
-
- Unit price
- per
Sold out