
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Hordeum vulgare (Barley)
Uniprot NO.:P12363
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ATQTVEDSSKPRPKRTGAGSLLKPLNSEYGKVAPGWGTTPFMGVAMALFAIFLSIILEIY NSSILLDGILTN
Protein Names:Recommended name: Photosystem II reaction center protein H Short name= PSII-H Alternative name(s): Photosystem II 10 kDa phosphoprotein
Gene Names:Name:psbH
Expression Region:2-73
Sequence Info:full length protein
You may also like
-
Recombinant Photosystem II reaction center protein H(psbH)
- Regular price
- £829.00 GBP
- Sale price
- £829.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Chara vulgaris Photosystem II reaction center protein H(psbH)
- Regular price
- £836.00 GBP
- Sale price
- £836.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Photosystem II reaction center protein H(psbH)
- Regular price
- £842.00 GBP
- Sale price
- £842.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Photosystem II reaction center protein H(psbH)
- Regular price
- £830.00 GBP
- Sale price
- £830.00 GBP
- Regular price
-
- Unit price
- per
Sold out