>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: HEV1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Hevea brasiliensis (Para rubber tree) (Siphonia brasiliensis)
Delivery time: 3-7 business days
Uniprot ID: P02877
AA Sequence: EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKDSGEGVGGGSASNVLATYHLYNSQDHGWDLNAASAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQSSCGKCLSVTNTGTGAKTTVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHITVNYQFVDCGDSFNPLFSVMKSSVIN
Tag info: N-terminal 6xHis-tagged
Expression Region: 18-204aa
Protein length: Full Length of Mature Protein
MW: 24.1 kDa
Alternative Name(s): Major hevein
Relevance: N-acetyl-D-glucosamine / N-acetyl-D-neuraminic acid binding lectin. Can inhibit fungal growth.
Reference: "Wound-induced accumulation of mRNA containing a hevein sequence in laticifers of rubber tree (Hevea brasiliensis)." Broekaert W.F., Lee H.I., Kush A., Chua N.H., Raikhel N. Proc. Natl. Acad. Sci. U.S.A. 87:7633-7637(1990)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.