Recombinant Helicobacter pylori Putative peptidyl-prolyl cis-trans isomerase HP_0175(HP-0175) (Active)

Recombinant Helicobacter pylori Putative peptidyl-prolyl cis-trans isomerase HP_0175(HP-0175) (Active)

CSB-EP345551HUV
Regular price
£409.00 GBP
Sale price
£409.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Others

Uniprot NO.:P56112

Uniprot Entry Name:

Gene Names:HP-0175

Species:Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Source:E.coli

Expression Region:22-299aa

Sequence:KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK

Protein Description:Full Length

Tag Info:N-terminal GST-tagged

Mol. Weight:58.8 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized yuaB at 5 ?g/ml can bind human HP_0175 with a linear range of 31.25-600.00 ng/ml.

Purity:Greater than 90% as determined by SDS-PAGE.

Endotoxin:Not test.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:Rotamase HP_0175

Relevance:

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Your list is ready to share