Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Haemophilus phage HP1 (Bacteriophage HP1)
Uniprot NO.:P51712
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNKRKQKQISRILAAKRAEKCGQINAELQETGEYLEGRVHLLRAKLSINGINLKAYVLEQ VINIKHQIVTERFGNVLLGLASGMIGGIIGMFMWVLCIL
Protein Names:Recommended name: Uncharacterized 11.1 kDa protein in rep-hol intergenic region Alternative name(s): ORF10
Gene Names:
Expression Region:1-99
Sequence Info:full length protein